PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold09320-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family M-type_MADS
Protein Properties Length: 433aa    MW: 49017.8 Da    PI: 9.0422
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold09320-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.17.3e-21952144
                                                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                                                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                                                          k i+n+  r vt+skR++g+ KKA+ELS+LC+++v+vii+++ +
  augustus_masked-scaffold09320-abinit-gene-0.0-mRNA-1  9 KLISNEKSRMVTYSKRKKGLKKKAYELSTLCGVDVCVIIYGPIQ 52
                                                          569**************************************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.6E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.324149IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-23298IPR002100Transcription factor, MADS-box
CDDcd002666.92E-16287No hitNo description
PRINTSPR004042.2E-12323IPR002100Transcription factor, MADS-box
PfamPF003195.6E-211152IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGRAKINMKL ISNEKSRMVT YSKRKKGLKK KAYELSTLCG VDVCVIIYGP IQKENSNELA  60
IWPENQEKVE KIINKYKGKS TGTRKKETLS LSDYFIQRKK NIEKEISRVR MESFEAMYST  120
WIEGLNSFSD AQKEVLLGLL DSKIDEVQRK INVLKGRNYL INDAALGIAS SSNFGSIRSD  180
FSYTQGMIQR SVAPKIINQQ PISYVKVKPL ENQLPTTWGE RFNNFSDAQR AVLRGILDNK  240
IDEVRRNIDV LNGGSYMTND AASGLTGSSN FGSIPTDFSY TQGMLQRNVE TSPINQQPIS  300
YVKPLDYQFP SCYSSDQSLF PLLPFDHLNP MANLMEVKGV DYSQFGGMSS SGIQYTPSND  360
QICYDPTVGM VDNVMVNNSR VPATHYHNPA MQQMVAYGQQ PMMQTFSSQI EGPPVGEFYN  420
INEFEMKNKM ERF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17485KYKGKSTGTRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023895408.10.0MADS-box transcription factor PHERES 2-like
TrEMBLA0A2N9JC250.0A0A2N9JC25_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.19e-24AGAMOUS-like 82