PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold08738-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 172aa    MW: 19501.1 Da    PI: 6.6505
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold08738-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-3881071100
                                                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57 
                                                           +CaaCk lrr+C+kdCvlapyfp ++p++fa+vhk+FGasn++k+l++lp + r++a
  augustus_masked-scaffold08738-abinit-gene-0.0-mRNA-1   8 RCAACKSLRRRCTKDCVLAPYFPPTNPQRFACVHKIFGASNITKMLEQLPVHLRPMA 64 
                                                           6******************************************************** PP

                                                DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                           ++++ +eA  r++dPvyG+v++i++lq+++ ++++el++++ e
  augustus_masked-scaffold08738-abinit-gene-0.0-mRNA-1  65 ADCMSFEASSRVEDPVYGSVRIISQLQEKIVEAQSELVKTNGE 107
                                                           *************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2457108IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-378104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MTMSHSTRCA ACKSLRRRCT KDCVLAPYFP PTNPQRFACV HKIFGASNIT KMLEQLPVHL  60
RPMAADCMSF EASSRVEDPV YGSVRIISQL QEKIVEAQSE LVKTNGEIAF HNAQQQLQQQ  120
QMQQLQMIHA VAQEGEDQPS WLSSSQQDPF SNVNQQLFGD YNYSSTFCGF EF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-3321085111LOB family transfactor Ramosa2.1
5ly0_B1e-3321085111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023893771.11e-105LOB domain-containing protein 24-like
SwissprotP594683e-42LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A1U8B9X88e-61A0A1U8B9X8_NELNU; LOB domain-containing protein 24-like
STRINGXP_010278070.11e-61(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-43LOB domain-containing protein 24