PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold05191-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 585aa    MW: 63671.3 Da    PI: 6.8117
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold05191-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83e-10427483561
                                                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                                                           kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +  l++
  augustus_masked-scaffold05191-abinit-gene-0.0-mRNA-1 427 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTT 483
                                                           9*******************************************9999877666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.0E-18423487IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.691425488IPR004827Basic-leucine zipper domain
PfamPF001704.5E-9427483IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10427481No hitNo description
SuperFamilySSF579592.46E-11427478No hitNo description
CDDcd147032.86E-24428477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MGDTEEANSD MMQRLQSSFG TSSSSILKQP LSMDQLNIPQ LSPSLNRARH FQQNFGGDSG  60
KRIGIPPSHP HQIPPISPYS QIPVSRPVNQ QMGSQNFSPG PTHSRSLSQP SSFFSLDSLP  120
PLSPSPFRDS SSMSMSEAGV STDVSMEDRN AGSHSLLPPS PYSTRGDSPR IGESLPPRKA  180
HRRSNSDIPF GFSSVMQSSP PLVPLRGPAG LERSVSGREN MGMAKPAQLV KRESSWERGG  240
DNNAEGMGER KSEGEVVDDL FSAYMNLDTI DALNSSGTDE KTGNENREDL DSRASGTKTN  300
GGDSSDNEAE SSVNESGGSV PRGGLNSTAE KREGVKRSAG GDVAPTTRHY RSVSMDSFMG  360
KLQFGDESPK MPPSPGTRPG QLSPNNSIDG NSNAFSLEFG NGEFSGAELK KIMANEKLAE  420
IALTDPKRAK RILANRQSAA RSKERKMRYI SELEHKVQTL QTEATTLSAQ LTLLQRDSVG  480
LTTQNNELKF RLQAMEQQAQ LRDALNDALT AEVQRLKLAT AELGGEHPSK CMVSQLNHQM  540
FQMQQQQQQS STQMNIHQLQ HQQQQQQQQS QQQNGSTASK SESIQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023883422.10.0transcription factor RF2a
TrEMBLA0A2N9G6H50.0A0A2N9G6H5_FAGSY; Uncharacterized protein
STRINGEOX978370.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-158bZIP family protein