PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold04931-abinit-gene-0.4-mRNA-1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 264aa    MW: 29073.4 Da    PI: 5.3875
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold04931-abinit-gene-0.4-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                                                           k  +r   NReA r++R++Kka+++ Le++v  L a N++L k+l+ 
  augustus_masked-scaffold04931-abinit-gene-0.4-mRNA-1  90 KGKKRPLGNREAVRKYREKKKARTASLEDEVVRLRALNQQLVKRLQG 136
                                                           66788899**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA: hitNo description
SMARTSM003382.6E-1186153IPR004827Basic-leucine zipper domain
PfamPF077166.4E-1587143IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.9988135IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.55E-791136No hitNo description
CDDcd146861.25E-1292145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023897864.10.0basic leucine zipper 23-like isoform X1
RefseqXP_023897865.10.0basic leucine zipper 23-like isoform X2
RefseqXP_023903682.10.0basic leucine zipper 23-like
SwissprotQ8GTS21e-116BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A2N9INI71e-158A0A2N9INI7_FAGSY; Uncharacterized protein
STRINGevm.model.supercontig_37.1361e-152(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-118bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640