PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold03666-abinit-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 560aa    MW: 62671.7 Da    PI: 4.9602
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold03666-abinit-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.16.9e-40201433128
                                                   NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekew 58 
                                                           pG+ FhPtd elvv+yL  k++++++++ e i+evd+yk++Pw+L  +++ +++ +w
  augustus_masked-scaffold03666-abinit-gene-0.5-mRNA-1  20 PGVGFHPTDVELVVYYLLWKATKRQFPI-ELIAEVDVYKFDPWKLAdESIVKGDLKW 75 
                                                           8***************************.89**************8667777889** PP

                                                   NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapk 115
                                                           yf ++ +kky +g r nrat+ g Wk tgkd++vl+ +++lvg  ktL+f+kg+ap 
  augustus_masked-scaffold03666-abinit-gene-0.5-mRNA-1  76 YFLCPIEKKYLSGVRMNRATDVGHWKITGKDRPVLH-DNALVGSIKTLIFHKGKAPG 131
                                                           ************************************.999************99986 PP

                                                   NAM 116 gektdWvmheyrl 128
                                                            e+tdWvmheyrl
  augustus_masked-scaffold03666-abinit-gene-0.5-mRNA-1 132 -ERTDWVMHEYRL 143
                                                           .9*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.44118166IPR003441NAC domain
SuperFamilySSF1019411.19E-4919166IPR003441NAC domain
PfamPF023653.2E-1920143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MEPREYVLDC LSGRKSFPIP GVGFHPTDVE LVVYYLLWKA TKRQFPIELI AEVDVYKFDP  60
WKLADESIVK GDLKWYFLCP IEKKYLSGVR MNRATDVGHW KITGKDRPVL HDNALVGSIK  120
TLIFHKGKAP GERTDWVMHE YRLDDKYLDE RGVAQSEHVL CKIFQKEGLG PRNNAQYGAP  180
FKEVDWIDDE EVNRSAGLSI PASVLPNNHS NSLAAGTSQL NSTASESCFS EIVPFQRVVL  240
PSVQSNNVDS KELPQILGDD VLFSTSLVSN EDRKNKKPIH DRRVDPNYKH LGYLVGPSED  300
VYTGSLYNGL LYNGLNIRDL DKPLNIHPEA GEPQHVPFNG LNAGHNDFID SEQFPTSKNT  360
MLDGTVDTEL TVDPISKDLE DLGNKAGSSE VGYVFHSGSL YNGLNMRDLD KPLNPEAGES  420
QHFPANSFGA PEVSYVPHQS DPWPDLPCQI ENASHNGTAE ASYSSDFFEG LENLGNTTSG  480
RGDVPSSSLE YFDMDDLWKL LGCPPETGES QHIQTNDPEQ FPVNSCHAAQ QLPASELSQK  540
DSSNKKERKR KRKEHNDERK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-362016719166NO APICAL MERISTEM PROTEIN
1ut4_B4e-362016719166NO APICAL MERISTEM PROTEIN
1ut7_A4e-362016719166NO APICAL MERISTEM PROTEIN
1ut7_B4e-362016719166NO APICAL MERISTEM PROTEIN
3swm_A5e-362016722169NAC domain-containing protein 19
3swm_B5e-362016722169NAC domain-containing protein 19
3swm_C5e-362016722169NAC domain-containing protein 19
3swm_D5e-362016722169NAC domain-containing protein 19
3swp_A5e-362016722169NAC domain-containing protein 19
3swp_B5e-362016722169NAC domain-containing protein 19
3swp_C5e-362016722169NAC domain-containing protein 19
3swp_D5e-362016722169NAC domain-containing protein 19
4dul_A4e-362016719166NAC domain-containing protein 19
4dul_B4e-362016719166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1544552KKERKRKRK
2547552RKRKRK
3547553RKRKRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023884331.10.0NAC domain-containing protein 82-like
STRINGXP_006464643.12e-84(Citrus sinensis)
STRINGXP_006432239.12e-84(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.46e-74NAC domain containing protein 82