PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold03654-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family ARR-B
Protein Properties Length: 697aa    MW: 76705.7 Da    PI: 6.73
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold03654-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like60.14.5e-19205248145
                                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtleh 45 
                                                           kpr++W+ +LH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+
  augustus_masked-scaffold03654-abinit-gene-0.0-mRNA-1 205 KPRVVWSVDLHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTREN 248
                                                           79*******************.********************987 PP

2Response_reg76.78.3e-26201281109
                                                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT CS
                                          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg 55 
                                                           vl vdD+p+ + ll+++l++ +y +v+++ ++ +al++l+e++  +Dl++ D++mp+
  augustus_masked-scaffold03654-abinit-gene-0.0-mRNA-1  20 VLAVDDDPTCLFLLEKLLRRCQY-HVTTTNQAIKALNMLRENKdqFDLVISDVQMPD 75 
                                                           799********************.***************888889************ PP

                                                           SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
                                          Response_reg  56 mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                                                           mdG++ll+     e++lp+i+++ +g+ +++ + +  Ga d+l Kp+ +eel +
  augustus_masked-scaffold03654-abinit-gene-0.0-mRNA-1  76 MDGFKLLELVGL-EMDLPVIMLSINGDTKLVMKGITHGACDYLLKPVRIEELKN 128
                                                           *******87754.558***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363927.7E-1561674IPR017053Response regulator B-type, plant
SuperFamilySSF521721.71E-3417139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.8E-4117167No hitNo description
SMARTSM004485.5E-3018130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.68219134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.0E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.00E-2621134No hitNo description
Gene3DG3DSA:1.10.10.605.5E-20202257IPR009057Homeodomain-like
SuperFamilySSF466893.05E-11203256IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-16205248IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MTVEAEIDDP RDQFPIGMRV LAVDDDPTCL FLLEKLLRRC QYHVTTTNQA IKALNMLREN  60
KDQFDLVISD VQMPDMDGFK LLELVGLEMD LPVIMLSING DTKLVMKGIT HGACDYLLKP  120
VRIEELKNIW QHVIRRKKFD SKDKNNCGNQ EKLHSGSVEG GPGSAGTLLD QNGKLNKKRK  180
DQDEEEVEEH DENGPDNDDP SNQKKPRVVW SVDLHRKFVA AVNQLGIDKA VPKKILDLMN  240
VEKLTRENKY RLYLKRISCV ANQQANMVAA LGGTDASFLQ MSSLNGVGNF QTLNGSGQFH  300
NTAFRSFPPN GMLGRLSTPA GLGIHGLSSS GMTQLGHSQN SGSSTIDQVN FQQVIIPGNH  360
NGSVLQGMPM SLQLDQLQNN KSLTRVRELS TAVDNTTVFP ISSGLPDARM TIGSSSNPLL  420
GVTNNTLMLE GAPQGAQTGK VFGNHSSVSF ASLNSELSSP LPDHRRLNDN WSTAQSSGIQ  480
SNSFSLNDTF KQVTMQPSNL RDNMSSMALQ IGHDPCNVSS VSSISTQSQD LRADVQCRTN  540
LISSNAGQVS NNAPAQRWDD HDQDGSYHSN VMCSSINSMI PVNGTVGPLG QNLEPKNTIF  600
HTNMDFNSME QSNFIDPLYM NHNEVNKSTM ETSLKLKQGL FMDQRKPQGS FISASFGSLE  660
DIVSAMAKQL CILKPLKIIK FWISPSNLHV LLPSHTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-19203258364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023883435.10.0two-component response regulator ARR12-like
SwissprotB8AEH11e-140ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A2N9GI700.0A0A2N9GI70_FAGSY; Two-component response regulator
STRINGXP_002515447.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-137response regulator 12