PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold03279-abinit-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YC
Protein Properties Length: 252aa    MW: 28333.8 Da    PI: 6.3414
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold03279-abinit-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC1794.4e-56741771101
                                                 NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelf 54 
                                                           ql++fw++q   ie+++dfknh+lPlarikki+kadedv+misaeaPv++++ace+f
  augustus_masked-scaffold03279-abinit-gene-0.3-mRNA-1  74 QLQNFWTNQyqeIEQTSDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFARACEMF 130
                                                           89******99999******************************************** PP

                                                 NF-YC  55 ileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                                                           ileltlrsw+h+eenkrrtl+k+diaaa+trtdifdflvdivpr++l
  augustus_masked-scaffold03279-abinit-gene-0.3-mRNA-1 131 ILELTLRSWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREDL 177
                                                           ********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471139.05E-3464168IPR009072Histone-fold
Gene3DG3DSA:1.10.20.106.1E-3887160IPR009072Histone-fold
PfamPF008081.5E-2196159IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MDQLGHGQPA GQVPYGLNPY QSNQMIGASQ PGSVGTMQSP SQTAGLSASS AQLAQHQLAY  60
QHIHHQQQQQ LQQQLQNFWT NQYQEIEQTS DFKNHSLPLA RIKKIMKADE DVRMISAEAP  120
VIFARACEMF ILELTLRSWN HTEENKRRTL QKNDIAAAIT RTDIFDFLVD IVPREDLKDE  180
VLASIPRAGN LPVGGDALPY YYMQPQHSSQ VGAPGMIMGK PVMDQVYGQQ TRPYMTQSAW  240
PHLQHEQPPS DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_C1e-4089174994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B1e-4089174994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4g91_C1e-407517419119HapE
4g92_C1e-407517419119HapE
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146152RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888275.11e-130PREDICTED: nuclear transcription factor Y subunit C-9-like
RefseqXP_015888276.11e-130PREDICTED: nuclear transcription factor Y subunit C-9-like
SwissprotQ8L4B22e-86NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLA0A061EMF21e-129A0A061EMF2_THECC; Nuclear transcription factor Y subunit C-9 isoform 1
STRINGVIT_05s0020g02790.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.49e-83nuclear factor Y, subunit C9