PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold02790-abinit-gene-0.8-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 290aa    MW: 33425.4 Da    PI: 9.0006
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold02790-abinit-gene-0.8-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.18.6e-5481371129
                                                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...e 54 
                                                           +ppGfrFhPtdeel+++yLkkkv+ +k+++ evi+evd++k+ePw+L++++k     
  augustus_masked-scaffold02790-abinit-gene-0.8-mRNA-1   8 VPPGFRFHPTDEELLHYYLKKKVSFQKFDM-EVIREVDLNKMEPWELQERCKIgstP 63 
                                                           69****************************.99**************9644442224 PP

                                                   NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykg 111
                                                           ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + + +++g++ktLvfy+g
  augustus_masked-scaffold02790-abinit-gene-0.8-mRNA-1  64 QNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-SYKKIGMRKTLVFYRG 119
                                                           55*************************************9.8999************ PP

                                                   NAM 112 rapkgektdWvmheyrle 129
                                                           rap+g+ktdW+mheyrle
  augustus_masked-scaffold02790-abinit-gene-0.8-mRNA-1 120 RAPHGQKTDWIMHEYRLE 137
                                                           ****************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-606159IPR003441NAC domain
PROSITE profilePS5100557.828159IPR003441NAC domain
PfamPF023654.4E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MASSSGGVPP GFRFHPTDEE LLHYYLKKKV SFQKFDMEVI REVDLNKMEP WELQERCKIG  60
STPQNEWYFF SHKDRKYPTG SRTNRATNAG FWKATGRDKC IRNSYKKIGM RKTLVFYRGR  120
APHGQKTDWI MHEYRLEDGD DPQENCNEDG WVVCRVFKKK NLFKVGNEGG SIINSDQQLN  180
INTLSTNQPR TFMHRDNQYQ STRQQHNNGN QPSFEPELAL HYTHIPAAAS SQYSLFQTQP  240
LIPSLKPLGG GYDYSTIPSD TPVMDANASS THQINQLSLR GEMDLWGYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52816117167NO APICAL MERISTEM PROTEIN
1ut4_B3e-52816117167NO APICAL MERISTEM PROTEIN
1ut7_A3e-52816117167NO APICAL MERISTEM PROTEIN
1ut7_B3e-52816117167NO APICAL MERISTEM PROTEIN
3swm_A4e-52816120170NAC domain-containing protein 19
3swm_B4e-52816120170NAC domain-containing protein 19
3swm_C4e-52816120170NAC domain-containing protein 19
3swm_D4e-52816120170NAC domain-containing protein 19
3swp_A4e-52816120170NAC domain-containing protein 19
3swp_B4e-52816120170NAC domain-containing protein 19
3swp_C4e-52816120170NAC domain-containing protein 19
3swp_D4e-52816120170NAC domain-containing protein 19
4dul_A3e-52816117167NAC domain-containing protein 19
4dul_B3e-52816117167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023885588.10.0protein BEARSKIN2
SwissprotQ9SV871e-128BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A2I4FTI41e-160A0A2I4FTI4_JUGRE; protein BEARSKIN2
STRINGPOPTR_0019s09400.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87523343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-130NAC domain containing protein 70
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]