PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GRAS
Protein Properties Length: 344aa    MW: 39046.8 Da    PI: 4.9799
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS243.49.1e-751934176373
                                                   GRAS  76 eelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqa 131
                                                             ++  l  f++++P+++f++ +aN aIl+aveg +++Hi+D+++++++Q p+L +a
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1  19 FSIIELASFVDLTPWHRFGFTAANAAILDAVEGYTAIHIVDLSMTHCMQIPTLVDA 74 
                                                            34444455************************************************ PP

                                                   GRAS 132 LasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl... 181
                                                            +a+R e pp l++T+v s e +      ++ e+g++L +fA++ +v +ef+v+   
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1  75 IANRHEVPPLLKLTVVTSLEDVppiLDLSYDELGSKLVNFARSKNVMMEFRVIpss 130
                                                            ******************998899889999**********************9876 PP

                                                   GRAS 182 vakrledleleeLrvkp......gEalaVnlvlqlhrll................d 215
                                                            + + +++l +e+Lrv++      +Eal++n++++lh+++                 
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1 131 YKDGFANL-IEQLRVQNyvyaesNEALVINCHMMLHYIPeetlvaiptsnsslyaY 185
                                                            55667777.99999999999999*******************************96 PP

                                                   GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                                                            e  +++s r+ +Lk+++sl P++vvvv+++ad +s++++ r+ +a++y +  +d++
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1 186 EFSPSSSLRTMFLKALRSLDPTIVVVVDEDADFTSNNLVCRLRSAFNYLWIPYDTM 241
                                                            6677777899********************************************** PP

                                                   GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                                                            ++ lpr s +r+++E+  + ++i+nv+a+eg +r+er e +++W +r+++a F+ +
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1 242 DSFLPRGSMQRQWYEAD-ICWKIENVIAHEGLQRVERLEPKSRWVQRMRNANFRGI 296
                                                            *****************.************************************** PP

                                                   GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                                            +++e+a++++k++l +++  g+ +++e++ lvl+Wk++++++++aW
  augustus_masked-scaffold02499-abinit-gene-0.12-mRNA-1 297 AFGEDAVSEVKTMLDEHA-AGWGLKKEEEDLVLTWKGHNVLFATAW 341
                                                            ******************.899************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.8271323IPR005202Transcription factor GRAS
PfamPF035143.1E-7219341IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MLAAMANAHS NLAMDVYKFS IIELASFVDL TPWHRFGFTA ANAAILDAVE GYTAIHIVDL  60
SMTHCMQIPT LVDAIANRHE VPPLLKLTVV TSLEDVPPIL DLSYDELGSK LVNFARSKNV  120
MMEFRVIPSS YKDGFANLIE QLRVQNYVYA ESNEALVINC HMMLHYIPEE TLVAIPTSNS  180
SLYAYEFSPS SSLRTMFLKA LRSLDPTIVV VVDEDADFTS NNLVCRLRSA FNYLWIPYDT  240
MDSFLPRGSM QRQWYEADIC WKIENVIAHE GLQRVERLEP KSRWVQRMRN ANFRGIAFGE  300
DAVSEVKTML DEHAAGWGLK KEEEDLVLTW KGHNVLFATA WVPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B7e-3327343172474Protein SHORT-ROOT
5b3h_B3e-3327343118420Protein SHORT-ROOT
5b3h_E3e-3327343118420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023922588.10.0scarecrow-like protein 32
SwissprotQ9SN221e-149SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2N9FI910.0A0A2N9FI91_FAGSY; Uncharacterized protein
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-151GRAS family protein