PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold02353-abinit-gene-0.1-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family M-type_MADS
Protein Properties Length: 337aa    MW: 38973.8 Da    PI: 8.7785
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold02353-abinit-gene-0.1-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.22.1e-181051243
                                                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                                                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                                           i+++  r+ tf kR++g++KKA+E S+LC+++ ++ii++++
  augustus_masked-scaffold02353-abinit-gene-0.1-mRNA-1 10 LIKSEKSRNMTFQKRKKGLMKKAYEFSTLCGVQTCMIIYGPK 51
                                                          59999***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.3E-17158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.825151IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-19298IPR002100Transcription factor, MADS-box
CDDcd002663.32E-21284No hitNo description
PRINTSPR004042.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003196.5E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRGKLPMEL IKSEKSRNMT FQKRKKGLMK KAYEFSTLCG VQTCMIIYGP KLQERPMELE  60
TWPQNRDEVV ERIKRYNENV VHKRPRGSNT LSDFFIERNK KVEIEILRLR KNIFKAKYPT  120
CDDRIETLPE DQLAVVLDVL DAKFEAVTRA MKMLQGKHLM IEKSSTSGNM LGGNVPHHPE  180
LMRNHYDSLQ MQALQCQDSS IKPLDIQFPT QFQSPQGSQM VPFNTSHYGD HMDNSFMNLL  240
YAADWTQFNT VSSNNIVPYA PLNDTSNYNI MPGMLENTVL NNPSASMNYY DLTKRFSIPQ  300
HVPYPMLPSI SSQTPSFQVN ELYDISQFDM KNKNAMM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023900519.10.0agamous-like MADS-box protein AGL14
TrEMBLA0A2N9FVF01e-150A0A2N9FVF0_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-21M-type_MADS family protein