PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold02294-abinit-gene-0.5-mRNA-1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 79aa    MW: 8621.62 Da    PI: 5.6128
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold02294-abinit-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                                DUF260  53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                            r  a++++ +e++ r++dPvyG+vg+i++lq+q+  +++el+++k+e
  augustus_masked-scaffold02294-abinit-gene-0.5-mRNA-1   3 LRAVAADCMSFESRSRVEDPVYGSVGIITQLQEQIIAAQSELVKTKDE 50 
                                                           58899**************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.211151IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-9348IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023892503.12e-27LOB domain-containing protein 24-like
TrEMBLA0A2K1YZY82e-17A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGXP_010270541.15e-17(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.11e-12LOB domain-containing protein 23