PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold01488-abinit-gene-0.14-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GeBP
Protein Properties Length: 407aa    MW: 45218 Da    PI: 4.8346
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold01488-abinit-gene-0.14-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573117.57.4e-37169264498
                                                 DUF573   4 qrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKir 59 
                                                             rlws+e e+++L+G+i++k+k+g +p +d+ +f+ef+kk+is++vsk+qlv+Kir
  augustus_masked-scaffold01488-abinit-gene-0.14-mRNA-1 169 PRLWSDENELAVLKGMIEYKSKKGLDPISDMGDFHEFIKKNISVEVSKNQLVDKIR 224
                                                            69****************************************************** PP

                                                 DUF573  60 rLKkKfkkkvkk.aksgkepsfskehdqkifelskkiWgs 98 
                                                            r+KkK+  +v+k +++g++p+fsk+h++ +felskkiWgs
  augustus_masked-scaffold01488-abinit-gene-0.14-mRNA-1 225 RMKKKYLVNVEKsRDNGENPVFSKPHEHRSFELSKKIWGS 264
                                                            *******999997899**********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.3E-32169263IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MAPKRLKEDP PPAATSSGEE EEDSENDAAS DEEEEEEHDV SNAVQEKEKS DDDDDEEEDD  60
DEESPAGKLT VIPSSNKVSN SNPQSDHESG SGSDSESESD SFDDKSSPPS PSLSAYTIKP  120
IASKPMEPKK SSAAAAKPNS SKKRKAVVSS SAITNGDDED LKKHTGGVPR LWSDENELAV  180
LKGMIEYKSK KGLDPISDMG DFHEFIKKNI SVEVSKNQLV DKIRRMKKKY LVNVEKSRDN  240
GENPVFSKPH EHRSFELSKK IWGSEAGSSR KAKPPTRGIA NNNINSNNNL IAIALPAKKK  300
EKEKEKEKEK EKEACFENGE VKDEKEEEFV ASYPCLNSVL ESGEEGFSRL GKRFKMELVT  360
GIGSAKAMEL ENKWKKVREA ELEVYVKRVE LVHEQAKLML EAFKNRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023871379.10.0STOREKEEPER protein-like
TrEMBLA0A2N9IYG21e-137A0A2N9IYG2_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.17e-27DNA-binding storekeeper protein-related transcriptional regulator