PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold01482-abinit-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family M-type_MADS
Protein Properties Length: 320aa    MW: 37532.1 Da    PI: 9.3177
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold01482-abinit-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.93.1e-19444343
                                                          --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                                                SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                                                           e++  r+vtf kR++g++KKA+E S+LC++e ++ii++++
  augustus_masked-scaffold01482-abinit-gene-0.3-mRNA-1  4 MESEKSRNVTFQKRKKGLMKKAYEFSTLCGVETCMIIYGPK 44
                                                          689999*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-10157IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.385144IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.02E-17191IPR002100Transcription factor, MADS-box
CDDcd002661.87E-19143No hitNo description
PfamPF003199.1E-19444IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-51631IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-53152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MKLMESEKSR NVTFQKRKKG LMKKAYEFST LCGVETCMII YGPKLQIRPM ELETWPQNHE  60
EAVKMINKYK VNIRHKRSRG STTLPDFFQE RNKKVDIEIS RLRKNIFKAK YPTWDDRIET  120
LPQDQLMAVL DVLDAKFKAM TRRMKMLQEK QLMVGGHVSH KPELTKNHFD NMQMQALQCQ  180
DSSVKRLDIQ WPTQFQTTQG SHMVPIDTSH YGDHMDNSLL NLLYGEDWTQ FDAVFSNNIV  240
QYAPLNDPSN YNMMHGMLEN KILNNSSASM NYNDLTRQFS TPQYVQYPML PNISSQMPGF  300
QVNELYDIGQ FNMKDKNAMI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023900519.10.0agamous-like MADS-box protein AGL14
TrEMBLA0A2N9FVF01e-144A0A2N9FVF0_FAGSY; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-21M-type_MADS family protein