PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold01213-abinit-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 256aa    MW: 27847.5 Da    PI: 6.353
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold01213-abinit-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26096.62.5e-304105197
                                                DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpee 52 
                                                           +C++C++lr++C+++C+++p++     p++q++++ +++k++G++ +++l++a pe+
  augustus_masked-scaffold01213-abinit-gene-0.9-mRNA-1   4 SCNGCRILRKGCSDSCTIRPCLqwiktPESQANATFFLAKFYGRAGLINLINAGPEH 60 
                                                           6******************************************************** PP

                                                DUF260  53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                                                            r+++++sl+yeA+ r+ +P+yG++g+++++++ql+q+++e++l 
  augustus_masked-scaffold01213-abinit-gene-0.9-mRNA-1  61 LRPAIFKSLLYEACGRIVNPIYGSTGLLWAGSWQLCQAAVEAVLK 105
                                                           ***************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.3883109IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-244103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MRLSCNGCRI LRKGCSDSCT IRPCLQWIKT PESQANATFF LAKFYGRAGL INLINAGPEH  60
LRPAIFKSLL YEACGRIVNP IYGSTGLLWA GSWQLCQAAV EAVLKGLPIT QVSSESAFKA  120
CDIRHVSKEE IQRPSDQLHK VKSRRSRFKK SSAASKLKPK VESVSDELAG DTWNVKKMSH  180
EDELGTSENP SCGGGAEAET ETETDCVSAE TVEASLAKSD ERADGSDVEL DLDLSLGLGN  240
WDRVTCKVDV DLVAHA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023926086.11e-156LOB domain-containing protein 40-like
SwissprotQ9M8864e-74LBD41_ARATH; LOB domain-containing protein 41
TrEMBLA0A2N9IN491e-108A0A2N9IN49_FAGSY; Uncharacterized protein
STRINGXP_006485788.14e-94(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.19e-73LOB domain-containing protein 41