PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00910-abinit-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family LBD
Protein Properties Length: 158aa    MW: 18036.2 Da    PI: 6.4917
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00910-abinit-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-4051041100
                                                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57 
                                                           +CaaCk+lrr+C++dC+++pyfp ++p++f +vh+++Gasnv k+l++lp + r++a
  augustus_masked-scaffold00910-abinit-gene-0.9-mRNA-1   5 RCAACKYLRRRCPSDCIFSPYFPPNDPQRFSCVHRIYGASNVGKMLQQLPSHLRSQA 61 
                                                           6******************************************************** PP

                                                DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                                           +++l++eA+ r++dPvyG+vg+i++l+qq++++++++a++++e
  augustus_masked-scaffold00910-abinit-gene-0.9-mRNA-1  62 ADTLYFEAQYRLQDPVYGCVGIISQLHQQINRAESQVAKIQAE 104
                                                           **************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5944105IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MISSRCAACK YLRRRCPSDC IFSPYFPPND PQRFSCVHRI YGASNVGKML QQLPSHLRSQ  60
AADTLYFEAQ YRLQDPVYGC VGIISQLHQQ INRAESQVAK IQAEISFLNS NAQEVEEPQV  120
DQHFEANSNF INNFLPEQIN TLDLSPYGLP STQTSWFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-36610512111LOB family transfactor Ramosa2.1
5ly0_B3e-36610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023896799.11e-107LOB domain-containing protein 24-like
SwissprotP594683e-51LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2N9EMF15e-79A0A2N9EMF1_FAGSY; Uncharacterized protein
STRINGPOPTR_0012s13910.17e-65(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-53LOB domain-containing protein 24