PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00906-abinit-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 567aa    MW: 64104.1 Da    PI: 4.5519
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00906-abinit-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52151412128
                                                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeek 56 
                                                           ppGfrFhPtdeelv +yLk+++ ++kl+l ++i+evd+yk++P++Lp +  +k++++
  augustus_masked-scaffold00906-abinit-gene-0.7-mRNA-1  15 PPGFRFHPTDEELVLYYLKRRICRRKLKL-DIIAEVDVYKWDPEELPgQsILKSGDR 70 
                                                           8****************************.99**************96446788999 PP

                                                   NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgra 113
                                                           +w++F++rd+ky++g r+nrat++gyWkatgkd+++++ ++++vg+kktLvfy+gra
  augustus_masked-scaffold00906-abinit-gene-0.7-mRNA-1  71 QWFYFTPRDRKYPNGGRSNRATRHGYWKATGKDRNITC-NSRTVGVKKTLVFYRGRA 126
                                                           **************************************.999*************** PP

                                                   NAM 114 pkgektdWvmheyrl 128
                                                           p+ge+tdWvmhey+l
  augustus_masked-scaffold00906-abinit-gene-0.7-mRNA-1 127 PHGERTDWVMHEYTL 141
                                                           *************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-598164IPR003441NAC domain
PROSITE profilePS5100555.0314164IPR003441NAC domain
PfamPF023655.6E-2715141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MTVQSESCMG DDGWPPGFRF HPTDEELVLY YLKRRICRRK LKLDIIAEVD VYKWDPEELP  60
GQSILKSGDR QWFYFTPRDR KYPNGGRSNR ATRHGYWKAT GKDRNITCNS RTVGVKKTLV  120
FYRGRAPHGE RTDWVMHEYT LDEEELKRCQ NVQDYYALYK LYKKSGPGPK NGEQYGAPFK  180
EEEWDDVDCP DFNNSVDRDI SVKQLDEVTS LTTVRVNGQV FDGFEEFMRQ IADDPVLEQP  240
QLGDCAFILS QVVGEEETQS TMVDPTSTEV MNAAPVEVLH PSGQLYDVQA SFGLTQSATS  300
QLQLYESPEV LSAPNLHGHE PFIIHEEDFL EIDDLIGPEP SFSNDRAVEN LQFENRNGDG  360
LSEFELFHDA ALFLHDMGPI DQATVADPYI NTLENNTVTQ FDYQLQPNLD GAGQNIDQLW  420
ALDERRNLYT SAESDLGHFP TLPSGVTNES TNYHTQANQN ENGNEDVGAA SRFSSALWSF  480
VESIPTTPAS ASENALVNRA FERMSSFSRV RMNIKNTNVS VGNGAESNKR RAGRSKGFIF  540
ISVIGVLCAI LWVLIGNVRL WGRCMST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-501514116140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023922687.10.0NAC domain-containing protein 17-like
TrEMBLA0A2N9H1E90.0A0A2N9H1E9_FAGSY; Uncharacterized protein
STRINGXP_008237396.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-145NAC domain containing protein 17