PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00800-abinit-gene-0.6-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family GATA
Protein Properties Length: 251aa    MW: 29110.6 Da    PI: 6.3739
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00800-abinit-gene-0.6-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.54.3e-19184218135
                                                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                                                           Cs+C + +Tp+WR+gp g+ktLCnaCG++y++ +l
  augustus_masked-scaffold00800-abinit-gene-0.6-mRNA-1 184 CSHCEAEETPQWREGPLGPKTLCNACGVRYKSGRL 218
                                                           *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.2E-15178228IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.543178214IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-13180239No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14182216IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.20E-15183232No hitNo description
PfamPF003206.1E-17184218IPR000679Zinc finger, GATA-type
PROSITE patternPS003440184209IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MVIYDMNHHE YEVWSELEAL NKTVSSSIDD DFGSTLATPQ DDLCDINFTM LSSNGLFIYS  60
DWNDFINNSD MEHNNSNLEQ ETIEGEKTRN KIAEVEEAVR REETNDRIAK ETKKSDAFKD  120
MNGVLVQSIE SFCQKPRTPM AKRLNTKNIY SLKEDLTTKR LNTKKIYTLK RKNKEEEETY  180
VRKCSHCEAE ETPQWREGPL GPKTLCNACG VRYKSGRLVP EYRPAASPTF DVNKYSNFHK  240
KILRNKGLDQ K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023896643.11e-145GATA transcription factor 11-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1634779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-32GATA transcription factor 4