PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00571-abinit-gene-0.8-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family HD-ZIP
Protein Properties Length: 355aa    MW: 39283.7 Da    PI: 7.3451
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00571-abinit-gene-0.8-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.6e-18181235256
                                                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                                              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                                           rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  augustus_masked-scaffold00571-abinit-gene-0.8-mRNA-1 181 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 235
                                                           778899***********************************************98 PP

2HD-ZIP_I/II127.46.3e-41181271192
                                           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktk 57 
                                                           +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+k
  augustus_masked-scaffold00571-abinit-gene-0.8-mRNA-1 181 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLK 237
                                                           69******************************************************* PP

                                           HD-ZIP_I/II  58 qlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                                                           q+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  augustus_masked-scaffold00571-abinit-gene-0.8-mRNA-1 238 QTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 271
                                                           ******************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-849144IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.4E-17165231IPR009057Homeodomain-like
SuperFamilySSF466893.51E-18172238IPR009057Homeodomain-like
PROSITE profilePS5007117.216177237IPR001356Homeobox domain
SMARTSM003897.7E-16179241IPR001356Homeobox domain
CDDcd000862.41E-15181238No hitNo description
PfamPF000463.1E-15181235IPR001356Homeobox domain
PROSITE patternPS000270212235IPR017970Homeobox, conserved site
SMARTSM003404.5E-26237280IPR003106Leucine zipper, homeobox-associated
PfamPF021837.3E-11237271IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELALSLGDA PKPFTFLDKT PKLSNKDLGF CMGLGTSSGS RSSDEKTREA RESEEDDGDE  60
RRRVSSDPPL QLDLLPFTPV LRTHQPSSQL RFPWLTDNLA SEPGSSDGPG RGLDVNRFPT  120
VATAAEETDD GAALSSPNST VSSFQMDFCV RNGGRSKRDL DVETERASSR ASDDEENGST  180
RKKLRLSKEQ SAFLEESFKE HSTLNPKQKL ALAKQLNLRP RQVEVWFQNR RARTKLKQTE  240
VDCEYLKRCC ETLTEENRRL QKELQELRAL KTSQPFYMQL PATTLTMCPS CERVATTTTT  300
TSGTNGNTTA TTTTATTTNN TTNSAAMSLA KARLYPFSSQ VQAHMQQAPA HQAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185TRKKLRL
2229237RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023916795.10.0homeobox-leucine zipper protein HOX11
SwissprotP466651e-105HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2N9HGR90.0A0A2N9HGR9_FAGSY; Uncharacterized protein
STRINGVIT_08s0007g06670.t011e-166(Vitis vinifera)
STRINGEOY095241e-166(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-84homeobox from Arabidopsis thaliana