PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00534-abinit-gene-0.10-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 267aa    MW: 30626.5 Da    PI: 5.3832
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00534-abinit-gene-0.10-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.22e-50101381129
                                                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeek 56 
                                                            lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k + +
  augustus_masked-scaffold00534-abinit-gene-0.10-mRNA-1  10 LPPGFRFYPSDEELVCHYLYKKITNEEVLK-GTLMEIDLHTCEPWQLPEVAKLNAT 64 
                                                            79************************9655.78***************88888999 PP

                                                    NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykg 111
                                                            ewyfFs rd+kyatg r+nrat+sgyWkatgkd++vl+  ++e vg++ktLvfy++
  augustus_masked-scaffold00534-abinit-gene-0.10-mRNA-1  65 EWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVLDPmSREIVGMRKTLVFYRN 120
                                                            **************************************978888************ PP

                                                    NAM 112 rapkgektdWvmheyrle 129
                                                            rap+g kt W+mhe+rle
  augustus_masked-scaffold00534-abinit-gene-0.10-mRNA-1 121 RAPNGIKTGWIMHEFRLE 138
                                                            ***************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-608156IPR003441NAC domain
PROSITE profilePS5100557.74810156IPR003441NAC domain
PfamPF023651.3E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLYK KITNEEVLKG TLMEIDLHTC EPWQLPEVAK  60
LNATEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV LDPMSREIVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKSKGL APNLEDSNQL MFETTSCGPT  180
SQTMPCGYNQ ITSFASTPSH HNQSNSLLNL LQFSQGTDTN NEITSKGDDE YGFLWDMNLE  240
EDSLGNGAPS NLEEMSRFEI DNGMVFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-46915616165NO APICAL MERISTEM PROTEIN
1ut4_B1e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_A1e-46915616165NO APICAL MERISTEM PROTEIN
1ut7_B1e-46915616165NO APICAL MERISTEM PROTEIN
3swm_A1e-46915619168NAC domain-containing protein 19
3swm_B1e-46915619168NAC domain-containing protein 19
3swm_C1e-46915619168NAC domain-containing protein 19
3swm_D1e-46915619168NAC domain-containing protein 19
3swp_A1e-46915619168NAC domain-containing protein 19
3swp_B1e-46915619168NAC domain-containing protein 19
3swp_C1e-46915619168NAC domain-containing protein 19
3swp_D1e-46915619168NAC domain-containing protein 19
4dul_A1e-46915616165NAC domain-containing protein 19
4dul_B1e-46915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023907574.10.0NAC domain-containing protein 21/22-like
SwissprotQ84TE69e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2N9EQA21e-178A0A2N9EQA2_FAGSY; Uncharacterized protein
STRINGEOX944241e-155(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.18e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]