PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00355-abinit-gene-0.3-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family bZIP
Protein Properties Length: 205aa    MW: 23602.3 Da    PI: 9.3383
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00355-abinit-gene-0.3-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.5e-11106150549
                                                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                                                bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                                                           ++ rr+++NRe+ArrsR RK++ +e+L++ v  +  eN++L ++l
  augustus_masked-scaffold00355-abinit-gene-0.3-mRNA-1 106 RKRRRMISNRESARRSRMRKQKHLENLRNQVNRFRVENRELSNRL 150
                                                           5789*************************************9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-15102166IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.404104150IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-11104150No hitNo description
SuperFamilySSF579591.21E-10106154No hitNo description
PfamPF001702.3E-8106150IPR004827Basic-leucine zipper domain
CDDcd147021.30E-19107158No hitNo description
PROSITE patternPS000360109124IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MLSALPIQPD SLFGNPFPAF ETGFTPWDCP EFFPTIQSPE PVISNSDSDA LQSTKSEPDV  60
FPSLNPVISS SGSGSDEPNR NHGDSDGPKH KRGAESVTVV GVVDERKRRR MISNRESARR  120
SRMRKQKHLE NLRNQVNRFR VENRELSNRL RFFLYHCHSV QTENNQLRSE YDMLRHKLSE  180
IRQFLVFRQL QPLTSTWPCN STSTQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105109RKRRR
2105126RKRRRMISNRESARRSRMRKQK
3118125RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023917022.11e-132basic leucine zipper 4-like
TrEMBLA0A2N9G0D71e-102A0A2N9G0D7_FAGSY; Uncharacterized protein
STRINGXP_006466428.13e-69(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54353254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.24e-44basic leucine-zipper 6