PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00033-abinit-gene-2.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NAC
Protein Properties Length: 404aa    MW: 45443.4 Da    PI: 7.4444
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00033-abinit-gene-2.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.2e-52151421128
                                                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeeke 57 
                                                           + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++eke
  augustus_masked-scaffold00033-abinit-gene-2.0-mRNA-1  15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKFATTGEKE 70 
                                                           579***************************.89***************8888899** PP

                                                   NAM  58 wyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgelvglkktLvfykgra 113
                                                           wyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +++ +glkk+Lvfykgra
  augustus_masked-scaffold00033-abinit-gene-2.0-mRNA-1  71 WYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGSKCIGLKKSLVFYKGRA 127
                                                           *************************************956677************** PP

                                                   NAM 114 pkgektdWvmheyrl 128
                                                            kg+ktdW+mhe+rl
  augustus_masked-scaffold00033-abinit-gene-2.0-mRNA-1 128 AKGVKTDWMMHEFRL 142
                                                           *************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-5814174IPR003441NAC domain
PROSITE profilePS5100557.04615174IPR003441NAC domain
PfamPF023651.4E-2517142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MDERIIDGDK LDEVMLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL  60
PKFATTGEKE WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSEG SKCIGLKKSL  120
VFYKGRAAKG VKTDWMMHEF RLPSLTDPTA PPKRFVDKSI PANDSWAICR IFKKTNSTTQ  180
RALSHSWVSP SPSETNTLDM LVKGPHCTQF SQENMSLTSK TNCSAATHFS INNDIQQLSS  240
TAFSPLDFVC YKSLNQLADK PSQLTGDLPS SFLFSPLETS TPTKCTVDIS SMLLNMPSSM  300
LGDYGTKVSE SIDYSGPQEH CNGFSFSLLQ DMQGNMASGG EQSNALMKNP NMAHADDHWE  360
TVRSIGFPLS LPMNNDAWKT NLVWDSSPCP SEMSTSFSTT KSYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5451806171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5451806171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5451806171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5451806171NO APICAL MERISTEM PROTEIN
4dul_A2e-5451806171NAC domain-containing protein 19
4dul_B2e-5451806171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023920077.10.0protein FEZ-like
SwissprotQ9ZVH01e-118FEZ_ARATH; Protein FEZ
TrEMBLA0A2N9EZA40.0A0A2N9EZA4_FAGSY; Uncharacterized protein
STRINGVIT_01s0026g02360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-117NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]