PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00019-abinit-gene-0.5-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Trihelix
Protein Properties Length: 225aa    MW: 25457.8 Da    PI: 8.9007
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00019-abinit-gene-0.5-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix605.8e-1939135286
                                              trihelix   2 WtkqevlaLiearremeerlrrgk.............lkkplWeevskkmrergfer 45 
                                                           Wt qe+l Li+a++ +eer  +                 + +W++v ++++ +g+ r
  augustus_masked-scaffold00019-abinit-gene-0.5-mRNA-1  39 WTIQETLILITAKKLDEERRVKPTstppdptnppckpGGELRWKWVENYCWNHGCLR 95 
                                                           *************9777766653235677777887778899**************** PP

                                              trihelix  46 spkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                                                           s++qC++kw+nl ++ykk+++ e+k ts+++ ++p + +le
  augustus_masked-scaffold00019-abinit-gene-0.5-mRNA-1  96 SQNQCNDKWDNLLREYKKVRDYESKSTSPNE-SFPSYWDLE 135
                                                           *************************988886.788888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.56231108IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.4E-535109IPR009057Homeodomain-like
PfamPF138371.4E-1338135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MSDLPKTLRP SNIPPLKPPI TTTTTTSSTL LREHRKGNWT IQETLILITA KKLDEERRVK  60
PTSTPPDPTN PPCKPGGELR WKWVENYCWN HGCLRSQNQC NDKWDNLLRE YKKVRDYESK  120
STSPNESFPS YWDLEKQHRK DRNLPSNMSF EVFQALNQVL QGRYSQTSTQ PAKPVLSFAH  180
SPAPVTVLPP NLPAPATEAT VPPVVSGTAE MPQGTDILRS NEISD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023902473.11e-119trihelix transcription factor ASR3-like
TrEMBLA0A2N9EPS21e-87A0A2N9EPS2_FAGSY; Uncharacterized protein
STRINGXP_008456886.13e-66(Cucumis melo)
STRINGXP_004169921.13e-66(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35640.12e-42Trihelix family protein