PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C027126P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GeBP
Protein Properties Length: 406aa    MW: 44833.7 Da    PI: 10.2753
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C027126P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573134.15e-42171267197
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     klfqrlwse+Dei++L G+id+ ak+g++ps d++af++f+kks++++v+k ql++KirrLKkK++++ ++ k+g +p+fsk+hdqk felsk+i
  MELO3C027126P1 171 KLFQRLWSEDDEIAILNGMIDYSAKKGSDPSLDMNAFHDFIKKSLHVDVTKAQLMDKIRRLKKKYRNNADRGKKGADPTFSKAHDQKGFELSKRI 265
                     579******************************************************************************************** PP

          DUF573  96 Wg 97 
                     Wg
  MELO3C027126P1 266 WG 267
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.7E-37173267IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSLRQRLPPK KKKPHQARRR KALINRDGSS SEEEEEDEEE TQAQTQKPKK PSSPSTPAVE  60
KKPVPKKSQP STNTQAQSSS SESGSGSDTD SDTESGRNVK PIASKPMEET PKVKKPRSKP  120
SASATPARPS LKKPGESTRH AKRPKKSSEA DADDGVVAED DSKKSVDESK KLFQRLWSED  180
DEIAILNGMI DYSAKKGSDP SLDMNAFHDF IKKSLHVDVT KAQLMDKIRR LKKKYRNNAD  240
RGKKGADPTF SKAHDQKGFE LSKRIWGGEG ILRTPAVEQL KPNANGTPKK NQRGNTGKSV  300
ASLKAELLPS PDAPKEDGKM KVDDCEAPSG CMDGFVAFER SLGAVGLPES FLKPRLELIG  360
QSKRTVLEEE WKKLHLAELE LFLKRTELIR DQTKLILDAY KSSSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6822250.0LN682225.1 Cucumis melo genomic scaffold, unanchored_scaffold00386.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465540.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0A0KN490.0A0A0A0KN49_CUCSA; Transcription regulator
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-43DNA-binding storekeeper protein-related transcriptional regulator