PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C027042P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SRS
Protein Properties Length: 266aa    MW: 28899 Da    PI: 6.4119
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C027042P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702101.91.1e-31101162667
          DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa 67 
                     +sCqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpa+krr+r  +   ++sk+ +++
  MELO3C027042P1 101 TSCQDCGNQAKKDCAHMRCRTCCKSRGFECETHVKSTWVPASKRRDRLLRSDGLNSKRPKDT 162
                     69*********************************************988888777766654 PP

2DUF70283.93.9e-2616422593154
          DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      + +++ l+++++P ev ++avfrcvr++++d+ ++++aYqtav+igGh+fkGiLyd+G+e+
  MELO3C027042P1 164 YHPTSSGLDMANFPMEVTTPAVFRCVRMTTLDETDDQYAYQTAVNIGGHIFKGILYDHGPEQ 225
                     455667889999************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-52101224IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.2E-27102144IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.2E-24176223IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAGFFPLDGG GSGGRVPNYH FPTPTTGGEI IHPTTEGLFW YKNYERLETW EGEEEHQQQQ  60
QPAQEQGGEG FVYSGDESPA RSSLVMVRSG RGGGSGGGPV TSCQDCGNQA KKDCAHMRCR  120
TCCKSRGFEC ETHVKSTWVP ASKRRDRLLR SDGLNSKRPK DTHYHPTSSG LDMANFPMEV  180
TTPAVFRCVR MTTLDETDDQ YAYQTAVNIG GHIFKGILYD HGPEQPPPPP SSSSAAALLD  240
STPPYPTPLS TYITAGTQFF LPPSS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator involved in the transcriptional regulation of terpene biosynthesis in glandular trichomes (PubMed:24884371, PubMed:24142382). Binds to the promoter of the linalool synthase TPS5 and promotes TPS5 gene transactivation (PubMed:24884371, PubMed:24142382). Acts synergistically with MYC1 in the transactivation of TPS5 (PubMed:24884371). {ECO:0000269|PubMed:24142382, ECO:0000269|PubMed:24884371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6820150.0LN682015.1 Cucumis melo genomic scaffold, unanchored_scaffold00177.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465489.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotK4B6C91e-52EOT1_SOLLC; Protein EXPRESSION OF TERPENOIDS 1
TrEMBLA0A1S3CNX30.0A0A1S3CNX3_CUCME; protein SHI RELATED SEQUENCE 1-like
STRINGXP_008465489.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2470533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.25e-51SHI-related sequence 7
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Spyropoulou EA,Haring MA,Schuurink RC
    RNA sequencing on Solanum lycopersicum trichomes identifies transcription factors that activate terpene synthase promoters.
    BMC Genomics, 2014. 15: p. 402
    [PMID:24884371]