PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025995P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 264aa    MW: 31782.3 Da    PI: 9.4277
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025995P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix71.51.5e-2232113286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W+  e+++L+++r  +++++++ k++  lW +v+ km+++gf+rs +qCk+kw+nl +ryk +++++ k    ++ ++p++d+l+
  MELO3C025995P1  32 WSVLETKELLAIRAALDKNFSEMKQNRMLWISVAGKMKAKGFNRSDEQCKCKWKNLVTRYKGCETMDPKA--LKH-QFPFYDDLH 113
                     9999****************************************************************95..444.79****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.0733188IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.6E-43187IPR009057Homeodomain-like
PfamPF138371.3E-1831114No hitNo description
CDDcd122035.37E-173295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MEDFCDLRRA VRLHRIAGVN ADQAAGDRFP PWSVLETKEL LAIRAALDKN FSEMKQNRML  60
WISVAGKMKA KGFNRSDEQC KCKWKNLVTR YKGCETMDPK ALKHQFPFYD DLHTIFTARM  120
QKNWWVEAEN RSGVLKRKAN EDPNGDRELE NEEKTKTKNV TKKRKWKRDN DLEEHERNLE  180
EILKGFLKRE MEMEREWREA FRVREEERRL KEEEWRMKME GIEREKMTME ILWRENEEKR  240
REREEARAQK TDALISALLT NLT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818840.0LN681884.1 Cucumis melo genomic scaffold, anchoredscaffold00086.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008464203.10.0PREDICTED: trihelix transcription factor GT-3b isoform X2
SwissprotO804501e-56TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0A0KZY41e-136A0A0A0KZY4_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s10240.13e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-43Trihelix family protein