PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025742P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 199aa    MW: 21505.3 Da    PI: 5.6692
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025742P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42371361100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+ Cvlapyfp ++p+kfa++h++FGasn++k+l++lpe++r da+sslvyeA ar+rdPvyG++g i +lq+q+++l+a+la
  MELO3C025742P1  37 PCAACKILRRRCAERCVLAPYFPPTEPAKFAIAHRVFGASNIIKFLQELPESQRADAVSSLVYEASARIRDPVYGSAGAICQLQKQVNELQAQLA 131
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MELO3C025742P1 132 KAQAE 136
                     *9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.14336137IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4237134IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEGSDSLTIT TVSSTPLSQS PSSSSSPAPP PPVILSPCAA CKILRRRCAE RCVLAPYFPP  60
TEPAKFAIAH RVFGASNIIK FLQELPESQR ADAVSSLVYE ASARIRDPVY GSAGAICQLQ  120
KQVNELQAQL AKAQAEVVNM QCQQANLVAF VCRELAQSHQ SFDEFNGSPH NGLLQSINPP  180
SYFDDSNNVN SLWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819220.0LN681922.1 Cucumis melo genomic scaffold, anchoredscaffold00082.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463908.11e-144PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0KCM51e-118A0A0A0KCM5_CUCSA; Uncharacterized protein
STRINGGLYMA13G40370.21e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-64LOB domain-containing protein 1