PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025701P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 162aa    MW: 18044.5 Da    PI: 4.7106
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025701P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601322.5e-4171061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp e+p kfa+vhk+FGasnv+k+l+++p ++r da+ss+vyeA ar++dPvyG+vg+i  lq+++++l+ +l 
  MELO3C025701P1   7 PCASCKLLRRRCAKDCIFAPYFPPEDPLKFAIVHKIFGASNVSKMLQEVPIDQRADAVSSMVYEASARMQDPVYGCVGTIAFLQNEVSRLEIQLG 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                     ++++e
  MELO3C025701P1 102 AAQAE 106
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.7376107IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-407104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGVGSSPCAS CKLLRRRCAK DCIFAPYFPP EDPLKFAIVH KIFGASNVSK MLQEVPIDQR  60
ADAVSSMVYE ASARMQDPVY GCVGTIAFLQ NEVSRLEIQL GAAQAEILTL QMRQQETSTT  120
FPTTTTQMDQ DEQNLMIFSN TDSSNSLHIF QATEDYYHMW T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819220.0LN681922.1 Cucumis melo genomic scaffold, anchoredscaffold00082.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463841.11e-120PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-67LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0A0KBK51e-104A0A0A0KBK5_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000782563e-69(Solanum tuberosum)
STRINGSolyc06g082310.2.13e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-67LBD family protein