PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025504P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 103aa    MW: 11653.8 Da    PI: 9.6206
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025504P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26074.52e-231682167
          DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67
                    +CaaCk+lrrkC+++C+lapyfp ++p kfa+vh+++Ga nv+k+ ++lpe   e++++++ y  ++
  MELO3C025504P1 16 PCAACKILRRKCVDNCILAPYFPPTDPLKFAAVHRIYGAGNVIKFFQELPERVGERMLRAVWYTKRM 82
                    7************************************************************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.82215102IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-221683IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
NTMQSPPPPC TVVLSPCAAC KILRRKCVDN CILAPYFPPT DPLKFAAVHR IYGAGNVIKF  60
FQELPERVGE RMLRAVWYTK RMQESETQSM GALVQYFNFK IK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132631e-100LN713263.1 Cucumis melo genomic chromosome, chr_9.
GenBankLN6818911e-100LN681891.1 Cucumis melo genomic scaffold, anchoredscaffold00079.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755107.13e-28PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK082e-28LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0A0KU202e-36A0A0A0KU20_CUCSA; Uncharacterized protein
STRINGSi024430m2e-27(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-29LOB domain-containing protein 11