PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025295P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 445aa    MW: 49038.4 Da    PI: 6.3087
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025295P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.6e-32239294156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  MELO3C025295P1 239 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 294
                     68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-17236297IPR009057Homeodomain-like
PROSITE profilePS5129413.355236296IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-28237297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26239294IPR006447Myb domain, plants
PfamPF002497.7E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MGSTAELSLE CKVESYSMLL KYSFGDHHDH DQSYDKLQDF VSRLEEERLK IDVFKRELPL  60
CMQLLTNAVE TSRRQLQACK TMEAAAAAAA PTEPILEEFM PLKNSTPAED EKTPTITSDK  120
ANWMTSVQLW SQAGDVISKQ QSESTDDHSK LQDCNNNKDN NLETCSQRIN NSGAFVPFNK  180
DRSSGPAAKM ELLEKGEKKN CSDNNSNIDG GVVMAAEQRS ENGAAEAGSA PTTTQTHRKA  240
RRCWSPDLHR RFVNALQMLG GSQVATPKQI RELMKVDGLT NDEVKSHLQK YRLHTRRPGP  300
TQQASGPPAA QLVVLGLGGL WVPPEYAAAA AAPPALYGPA ATSHPASHFY TPPEFYARTA  360
PAPHLQHHHH HQVQLYKGAP PQATQSSPES EVRDTAERSE SFEEEKSGST SWRIEGGENA  420
RGSCGRRSEE NEESNNRSEI TLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-13239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13239292255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818100.0LN681810.1 Cucumis melo genomic scaffold, anchoredscaffold00077.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463337.10.0PREDICTED: transcription activator GLK1-like
TrEMBLA0A1S3CJ160.0A0A1S3CJ16_CUCME; transcription activator GLK1-like
STRINGXP_008463337.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-94G2-like family protein