PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025116P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 227aa    MW: 25351.7 Da    PI: 10.0498
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025116P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.82.9e-29152203253
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                     pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ +
  MELO3C025116P1 152 PRMRWTSSLHAQFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQVF 203
                     9*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.45E-15149205IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-25150203IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-23152204IPR006447Myb domain, plants
PfamPF002495.1E-6153201IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MPNIQRVINI ESSSSSSSSS SSSSSTPFLD LSLQISPPNS IINHSTFPTN TIETSNGSTN  60
QLFTHHYTNK SLNQINNGVS LDHHHACPIN GFPIHPNPSI FYPKQRLTSP AFSGASSSSS  120
ISTFTLPPPY LHYHLDSDRL SAVARGRSMR APRMRWTSSL HAQFVHAVEL LGGHERATPK  180
SVLELMDVKD LTLAHVKSHL QVFFFSFFFF HIIFNFYIKF KLLMYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-16153203454Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818940.0LN681894.1 Cucumis melo genomic scaffold, anchoredscaffold00074.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463176.11e-144PREDICTED: probable transcription factor KAN2
TrEMBLA0A1S3CJ011e-143A0A1S3CJ01_CUCME; probable transcription factor KAN2
STRINGXP_008463176.11e-143(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-31G2-like family protein