PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C025049P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 262aa    MW: 27495.8 Da    PI: 9.5631
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C025049P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1164.8e-3640111273
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                     ++kk++ +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i++ tgt++++as++
  MELO3C025049P1  40 PVKKTPYKDRHSKVDGRGRRIRMPIVCAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIATTGTGTTPASFS 111
                     579*************************************************************99999777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-3146121IPR005333Transcription factor, TCP
PROSITE profilePS5136926.51446100IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MSASDGVNNN NAAIIDPSHQ QHIHQIQANQ SSNNATTPLP VKKTPYKDRH SKVDGRGRRI  60
RMPIVCAARV FQLTRELGHK SDGQTIEWLL RQAEPSIIAT TGTGTTPASF STISASLRTP  120
PAASVFDHKP LLPPAPFILG KRVRTDDDEA NKDDTGGDGP GISVGPSIGS IMGPAVAGGY  180
WAIPARSDFG QLWSFAAAAA APEMVIQPTA VSHQASLFVQ QQSMGEASAA KVGNYLPGHL  240
NLLASLSGGP GSSGRRDNDH R*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818940.0LN681894.1 Cucumis melo genomic scaffold, anchoredscaffold00074.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463113.10.0PREDICTED: transcription factor TCP21-like
SwissprotQ9FMX23e-84TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A1S3CIF90.0A0A1S3CIF9_CUCME; transcription factor TCP21-like
STRINGXP_008463113.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.17e-65TCP family protein