PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024507P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 199aa    MW: 22905.8 Da    PI: 6.6833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024507P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.92.3e-204396356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    k+ +++++qle+Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  MELO3C024507P1 43 KKKRLSQDQLEALERSFQEEVKLDPDRKMKLSMELGLQPRQIAVWFQNRRARWK 96
                    56779************************************************9 PP

2HD-ZIP_I/II1201.2e-3842134193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kk+rls++q+++LE+sF+ee kL+p+rK++l+ eLglqprq+avWFqnrRAR+ktkqlE+ y++Lk+++d++++e+++L++ev +Lr+ l+e
  MELO3C024507P1  42 QKKKRLSQDQLEALERSFQEEVKLDPDRKMKLSMELGLQPRQIAVWFQNRRARWKTKQLEHLYDTLKQQFDTISKEKHNLQQEVMKLRNMLRE 134
                     69**************************************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.9893898IPR001356Homeobox domain
SuperFamilySSF466892.61E-1940100IPR009057Homeodomain-like
SMARTSM003892.6E-1841102IPR001356Homeobox domain
CDDcd000861.35E-164299No hitNo description
PfamPF000461.3E-174396IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-2144105IPR009057Homeodomain-like
PRINTSPR000315.9E-56978IPR000047Helix-turn-helix motif
PROSITE patternPS0002707396IPR017970Homeobox, conserved site
PRINTSPR000315.9E-57894IPR000047Helix-turn-helix motif
PfamPF021838.6E-998132IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MVIKEETDRY SQPSSVQLVI ETATRVATGE GKQNMAGGVD HQKKKRLSQD QLEALERSFQ  60
EEVKLDPDRK MKLSMELGLQ PRQIAVWFQN RRARWKTKQL EHLYDTLKQQ FDTISKEKHN  120
LQQEVMKLRN MLREQTTRNA GSMAHTDISG EETTVECTSV EILSCNNYMY NVEDFNQISA  180
SAPPFWWGAE AAHLPSYP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19098RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818760.0LN681876.1 Cucumis melo genomic scaffold, anchoredscaffold00068.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462523.11e-134PREDICTED: homeobox-leucine zipper protein ATHB-22-like
SwissprotQ9LZR06e-46ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLA0A1S3CIQ61e-133A0A1S3CIQ6_CUCME; homeobox-leucine zipper protein ATHB-22-like
STRINGXP_008462523.11e-134(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.12e-48homeobox 51
Publications ? help Back to Top
  1. Andres RJ, et al.
    Modifications to a LATE MERISTEM IDENTITY1 gene are responsible for the major leaf shapes of Upland cotton (Gossypium hirsutum L.).
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. E57-E66
    [PMID:27999177]
  2. Vuolo F, et al.
    LMI1 homeodomain protein regulates organ proportions by spatial modulation of endoreduplication.
    Genes Dev., 2018. 32(21-22): p. 1361-1366
    [PMID:30366902]