PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024459P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 208aa    MW: 22192.9 Da    PI: 8.3552
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024459P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP1097.1e-3454132684
             TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasn 84 
                     ++++++h kv+gR+RRvR++a+caar+F+L++eLG+ + ++tieWLl+qa+p+i+++tgt++ ++   +++ss  ++s 
  MELO3C024459P1  54 SSSKDRHIKVNGRGRRVRMPALCAARIFQLTRELGHRSEGETIEWLLRQAEPSIIAATGTGTVPSGPISTVSSAMASSG 132
                     689*********************************************************9998855544444443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.6E-3055169IPR005333Transcription factor, TCP
PROSITE profilePS5136926.53756110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGSDIVLHKF PSSSDPHSQP PTASHSVVGS NSSPATISRQ SLLPRKSNTS LSSSSSKDRH  60
IKVNGRGRRV RMPALCAARI FQLTRELGHR SEGETIEWLL RQAEPSIIAA TGTGTVPSGP  120
ISTVSSAMAS SGRSVSCRIQ PVTVGGSGQG MFSMPPPSCR LDLCQPVGME YSAAGNDYRH  180
MPFTALLLQP STGEETEERQ EEEVFRE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818760.0LN681876.1 Cucumis melo genomic scaffold, anchoredscaffold00068.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462463.11e-146PREDICTED: uncharacterized protein LOC103500811
SwissprotQ9SJK78e-45TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A1S3CGZ31e-145A0A1S3CGZ3_CUCME; uncharacterized protein LOC103500811
STRINGXP_008462463.11e-146(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.15e-45TCP family protein