PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024387P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 289aa    MW: 32397.2 Da    PI: 5.6061
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024387P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601279.1e-40331321100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ e+e+am+++++++++r  dPv G++++i++lq+q+e  kael+
  MELO3C024387P1  33 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKNLDPFEKEEAMRTIIFQSDVRSVDPVGGCYRIIRDLQRQIEYNKAELE 127
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  MELO3C024387P1 128 IVLHQ 132
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.29332133IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-3733128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSPITHHHHN HHHHLSKSST APVTTTTSST TQACAACKYQ RRKCAPDCIL APYFPHDRQR  60
QFLNAHKLFG VSNITKIIKN LDPFEKEEAM RTIIFQSDVR SVDPVGGCYR IIRDLQRQIE  120
YNKAELEIVL HQLAICKQQA AAAAAAAAAA AILEGDPMSG YSGIEHQFVE GYEGEGFVVG  180
ENENGESLED QEVEVWGIQD SSCSSLQLKQ AGSVHDFHDI KIDDNNQQHQ QQLKFQIDHH  240
DLVHRSEEPM LKMDNMILKE DSDPIQQVQD QELKGAIDTL FTFPTCDT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462351.10.0PREDICTED: LOB domain-containing protein 22
SwissprotQ9LRW11e-55LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0A0K9M31e-168A0A0A0K9M3_CUCSA; Uncharacterized protein
STRINGGLYMA07G01170.22e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-55LOB domain-containing protein 22