PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024256P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 739aa    MW: 82343.3 Da    PI: 6.2901
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024256P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.94.8e-2083138156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++ ++t+eq++e+e lF+++++p++++r++L++klgL+ +q+k+WFqNrR++ k
  MELO3C024256P1  83 KKRKNRHTSEQIREMEMLFKESPHPDEKQRQQLSEKLGLSCKQIKFWFQNRRTQIK 138
                     678889**********************************************9877 PP

2START195.52.5e-612594775205
                     HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
           START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                     +a +e+vk+ ++eep+Wv+s+    e +n+d+++++++ ++    +++ea+r++gvv+++l++lv++++d+  qW+e+++    ka+t+ev+ +g
  MELO3C024256P1 259 RAIEEVVKMGDSEEPLWVRSVetgrELLNYDVYRKELAVGNErgkREVEASRETGVVFADLHRLVQSFMDVV-QWKEMFPsmisKASTMEVVFNG 352
                     6889********************999**********88887999***************************.********************** PP

                     ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSX CS
           START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrl 176
                           ga+qlm+aelq+l+p+ p R+  fvR+++ql+ g+wv++dvS+d   +   sss  R++++pSg++i+++s+gh+kvtwveh+++ + +
  MELO3C024256P1 353 dgnnrdGAVQLMFAELQMLTPTIPpREIFFVRSCKQLSPGKWVVADVSIDKVGDHLDSSSASRCRKRPSGCIIQDTSDGHCKVTWVEHWECHKII 447
                     **********************999***************************99877************************************** PP

                     X.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 177 p.hwllrslvksglaegaktwvatlqrqce 205
                       h ++r +v+sgl++ga +w++tlq +ce
  MELO3C024256P1 448 GlHTIYRTIVNSGLIFGATHWMSTLQMHCE 477
                     *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-2071134IPR009057Homeodomain-like
SuperFamilySSF466891.46E-1872139IPR009057Homeodomain-like
PROSITE profilePS5007117.7580140IPR001356Homeobox domain
SMARTSM003892.5E-1882144IPR001356Homeobox domain
CDDcd000867.39E-1883138No hitNo description
PfamPF000461.4E-1783138IPR001356Homeobox domain
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PROSITE profilePS5084836.757246481IPR002913START domain
CDDcd088751.13E-93250477No hitNo description
SuperFamilySSF559613.23E-29253477No hitNo description
SMARTSM002342.9E-56255478IPR002913START domain
PfamPF018524.4E-49259477IPR002913START domain
Gene3DG3DSA:3.30.530.208.5E-8306476IPR023393START-like domain
SuperFamilySSF559614.33E-10521725No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MAVVMSDNHA SRRLKTLPSS PALSLTLAGV FENAGPMDVE ADTTGRRDDS CSDNSEPAGS  60
RSAEDLGVDP DDEDEDKLQG NTKKRKNRHT SEQIREMEML FKESPHPDEK QRQQLSEKLG  120
LSCKQIKFWF QNRRTQIKAI HERHENALLK GEMEKLREEN QAMREMISKS SCPKGCCSAS  180
TNSLDPVFNT SDQQQQQLVT EIARLKAEVE RLRTALDKYA PAETENSKEE GGIERGRNLE  240
KSKSILGLEK GRVMLIGKRA IEEVVKMGDS EEPLWVRSVE TGRELLNYDV YRKELAVGNE  300
RGKREVEASR ETGVVFADLH RLVQSFMDVV QWKEMFPSMI SKASTMEVVF NGDGNNRDGA  360
VQLMFAELQM LTPTIPPREI FFVRSCKQLS PGKWVVADVS IDKVGDHLDS SSASRCRKRP  420
SGCIIQDTSD GHCKVTWVEH WECHKIIGLH TIYRTIVNSG LIFGATHWMS TLQMHCEWQV  480
FFMATNVPMK DSTGITTVGG RKSVLRLAQR MTSSIYQAIG ASSSHTWTKV QSKIGETIRI  540
ASRKNLKNPH EPTGLILCAV ASVWLPVSPK ILFEFLIDEA RRPEWDVMLS GGQVEMLANF  600
AKGQNRGNAV TIQAIKSDES NKWILQDSLT NEYESTVVYA EVDMNSMKSV MAGFDSGNIT  660
TLPTGFSILP DGHPTRPLVI SSSKEERETG GSLLTVASQI LVSPSPTAET TSQSVEYVNN  720
IISHTLENIK ASLQGEDD*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462169.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A1S3CGV00.0A0A1S3CGV0_CUCME; homeobox-leucine zipper protein GLABRA 2
STRINGXP_008462169.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47143352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553
    [PMID:28526410]