PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C023937P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 255aa    MW: 28885.6 Da    PI: 9.326
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C023937P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.53.5e-16134188256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++++ q   Lee F++++++  +++ e A++l+L  rqV vWFqNrRa+ k
  MELO3C023937P1 134 RKKLRLSRRQSAFLEESFKQHHTLYPKQKLEVARRLNLRPRQVEVWFQNRRARTK 188
                     6778899**********************************************98 PP

2HD-ZIP_I/II113.11.8e-36134224192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rls+ q+++LEesF+++++L p++K e+ar+L+l+prqv+vWFqnrRARtk+kq E+++e+Lk+++ +l+++n++L+ke ++Lr +lk
  MELO3C023937P1 134 RKKLRLSRRQSAFLEESFKQHHTLYPKQKLEVARRLNLRPRQVEVWFQNRRARTKLKQNEVECEYLKKCCATLTQQNTKLQKELQDLR-ALK 224
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.88E-16126191IPR009057Homeodomain-like
PROSITE profilePS5007116.05130190IPR001356Homeobox domain
SMARTSM003896.1E-13132194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.9E-16133194IPR009057Homeodomain-like
CDDcd000863.03E-12134191No hitNo description
PfamPF000461.1E-13134188IPR001356Homeobox domain
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
SMARTSM003402.2E-16190233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MELDLRLGND PSPSSHPTPL HFSLSFSSLE LQHQARNHIH QNHLLLHSLN SPPPPAASAS  60
RPSSPTERSR GKVFTEVISE ATADGGGEIG RRSSKGIVWS IGKNNSEEER EGKSENEEEE  120
EQEEMDMNMI SGGRKKLRLS RRQSAFLEES FKQHHTLYPK QKLEVARRLN LRPRQVEVWF  180
QNRRARTKLK QNEVECEYLK KCCATLTQQN TKLQKELQDL RALKTTHSLF INSPPTTLTL  240
CASCERAVAT PISR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818351e-154LN681835.1 Cucumis melo genomic scaffold, anchoredscaffold00064.
GenBankLN7132581e-154LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461760.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
TrEMBLA0A1S3CFB90.0A0A1S3CFB9_CUCME; homeobox-leucine zipper protein HOX11-like
STRINGXP_008461760.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3151522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-53homeobox from Arabidopsis thaliana