PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C023227P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41987.3 Da    PI: 6.6403
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C023227P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF581.2e-18952144
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    k i+n+  r++tf kR++ +l KA+ELS+LCd++v+v + ++++
  MELO3C023227P1  9 KLISNEKSRKTTFHKRKASLLRKAYELSTLCDVRVCVFVHGPNQ 52
                    569**************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.217147IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-18160IPR002100Transcription factor, MADS-box
CDDcd002662.61E-22290No hitNo description
SuperFamilySSF554557.72E-202101IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-9323IPR002100Transcription factor, MADS-box
PfamPF003195.7E-171152IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRGKLSMKL ISNEKSRKTT FHKRKASLLR KAYELSTLCD VRVCVFVHGP NQSNDQSPLQ  60
LHTWPPCPDE VNSMIASYKT NCLHKRARKA FGLIDFFSER KKKVETDMSK LRKDVAEARF  120
TKWDERLDHL LEDQLRVLMM ELDSKIEIAK KRIEIETECY NVEEGTSVES SQTLNANMKH  180
KQVMGFDPEE ESTNYGMFGI RSSMEQTQGT MPFHQQYHHQ QQLQTMAQSC LQMDHEIETL  240
SPFLFGSNGS APQFQLSCGS NNNNNNNCFQ NYPHSFYNDP TNGMIMENTQ SYSSMCHYGV  300
PFGTQSVVPI SYMQMQQLTG ADDQMMMGYA SSSQMPLPNS ASSQVINDQF DFYNSYEYFM  360
KPNSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460878.10.0PREDICTED: MADS-box protein SOC1-like
TrEMBLA0A1S3CDG60.0A0A1S3CDG6_CUCME; MADS-box protein SOC1-like
STRINGXP_008460878.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-20M-type_MADS family protein