PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022532P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 873aa    MW: 93910.8 Da    PI: 5.9167
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022532P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-20166221156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  MELO3C022532P1 166 KKRYHRHTPQQIQELEAVFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 221
                     688999***********************************************999 PP

2START210.18.5e-663746001206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a+ +ep+W  s     e++n++e++++f++  +     + +ea+r+sg+v+ ++  lve+l+d++ +W e+++    + +t+
  MELO3C022532P1 374 ELALAAMDELVKMAQTDEPLWIGSLeggrEILNQEEYIRTFTPCIGmkpngFVTEASRESGMVIINSLALVETLMDSN-RWAEMFPcmiaRTTTT 467
                     5899**************************************9988999*9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwve 168
                     +vis+g      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++ p+   ss+  +++lpSg+++++++ng+skvtwve
  MELO3C022532P1 468 DVISNGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDAMRETPTggGSSFGNCRRLPSGCVVQDMPNGYSKVTWVE 562
                     *************************************************************999******************************* PP

                     -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     h++++++++h+l+r+l++sg+ +ga++wv tlqrqce+
  MELO3C022532P1 563 HAEYDDSQVHQLYRPLLSSGMGFGAQRWVTTLQRQCEC 600
                     ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-21148223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-22153223IPR009057Homeodomain-like
PROSITE profilePS5007117.2163223IPR001356Homeobox domain
SMARTSM003896.3E-18164227IPR001356Homeobox domain
CDDcd000869.53E-19165223No hitNo description
PfamPF000463.0E-18166221IPR001356Homeobox domain
PROSITE patternPS000270198221IPR017970Homeobox, conserved site
PROSITE profilePS5084843.789365603IPR002913START domain
SuperFamilySSF559615.56E-33367600No hitNo description
CDDcd088755.08E-125369599No hitNo description
PfamPF018521.3E-57374600IPR002913START domain
SMARTSM002342.7E-51374600IPR002913START domain
SuperFamilySSF559612.43E-23628798No hitNo description
SuperFamilySSF559612.43E-23825865No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MSFGGFLDGG GGGGGGGARI LADLPYTNNS TTNANNNPTG GIGGGGNMSS SAIAPPRLIT  60
QSLTKSMFNS PGLSLALVLI FFPLFFLRYS FRLFLCVVVP ISNGFENPQT NMDGGQGDLA  120
ARLPEGFEHN VGRRGREEEH ESRSGSDNMD GGSGDDQDAA DNPPRKKRYH RHTPQQIQEL  180
EAVFKECPHP DEKQRLELSR RLCLETRQVK FWFQNRRTQM KTQLERHENT LLRQENDKLR  240
AENMSIRDAM RNPICSNCGG PAIIGEISLE EQQLRIENAR LKDELDRVCA LAGKFLGRPI  300
SSLANSIAPP LPSSSLELGV GSNGFGSLTM ATSMPIGPDF GGGLSGNLAV VQAPARPTPG  360
MGLDRSVERS MLLELALAAM DELVKMAQTD EPLWIGSLEG GREILNQEEY IRTFTPCIGM  420
KPNGFVTEAS RESGMVIINS LALVETLMDS NRWAEMFPCM IARTTTTDVI SNGMGGTRNG  480
ALQLMHAELQ VLSPLVPVRE VNFLRFCKQH AEGVWAVVDV SVDAMRETPT GGGSSFGNCR  540
RLPSGCVVQD MPNGYSKVTW VEHAEYDDSQ VHQLYRPLLS SGMGFGAQRW VTTLQRQCEC  600
LAILMSSAVP IRDHTAITAG GRRSMLKLAQ RMTANFCAGV CASTVHKWNK LNAGSVDEDV  660
RVMTRKSVDD PGEPPGIVLS AATSVWLPVS PQRLFDFLRD ERLRSEWDIL SNGGPMQEMA  720
HIAKGQDHGN CVSLLRASAM NANQSSMLIL QETCIDAAGS LVVYAPVDIP AMHVVMNGGD  780
SAYVALLPSG FAIVPDGAVT GGLTATNGSS PSGGEGPQSQ RAAGGGSLLT VAFQILVNSL  840
PTAKLTVESV ETVNNLISCT VQKIKAALQC ET*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460172.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S3CBG80.0A0A1S3CBG8_CUCME; homeobox-leucine zipper protein ANTHOCYANINLESS 2
STRINGXP_008460172.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]