PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022331P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 295aa    MW: 31699.2 Da    PI: 8.5455
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022331P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.45.3e-3867153288
             TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                     a+k+++++++h kv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  a+  s s++ ss +
  MELO3C022331P1  67 APKRTSNKDRHKKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETIQWLLQQAEPSIIAATGSGTIPASALHAAGVSLSDHDSSVS 153
                     789******************************************************************877444444444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.3E-3271163IPR005333Transcription factor, TCP
PROSITE profilePS5136927.38173127IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MADQNNNNNN NNKHHPLLPS PATSSSPLTT PPLPTPSSDI KDFTLIISNK DQNNSNSNSN  60
NNNKQLAPKR TSNKDRHKKV DGRGRRIRMP ALCAARVFQL TRELGHKTDG ETIQWLLQQA  120
EPSIIAATGS GTIPASALHA AGVSLSDHDS SVSVSASLTP KIEAVPRTNW AMMGANLSRS  180
HMATPGFWPS LGGIGTGFVS ENPGSIMPKF GFHGFEFQGM NLGSVNFPGM IGNQHQQIPG  240
LELGLSQDGN NLRGMLNPPS FSQIYHQIGQ NRESSAPPLE QDQAPEKDDS QESR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459878.10.0PREDICTED: transcription factor TCP20-like
RefseqXP_016902500.10.0PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD51e-70TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A1S3CAQ40.0A0A1S3CAQ4_CUCME; transcription factor TCP20-like
STRINGXP_008459878.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33393269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-65TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]