PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022302P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 737aa    MW: 80612.1 Da    PI: 6.1208
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022302P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   MELO3C022302P2 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.0E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.0E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-82464IPR009057Homeodomain-like
CDDcd001671.40E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MDPNSSGEDL VFKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALVKG IPVGQTLDID IPPPRPKRKP SNPYPRKTPI SKLGANDGKV  120
LTLVSSSQRK QILDLEKEPL NEGTSGEEQA TNEKDTHDDN YSEVFTLSRE ANSISWKNTN  180
CVPSQVKLND SCAFREFVPS LKEPLQDKGP GKVLELEISS TSQEKSIPAE KKEALSCVLS  240
GDEMQAAHNY PRHVPVHVVD GSLGANVQGS VTNTPLQEST FHPAMEVRGE HNIIGNPSDS  300
VTFEHQNNAP RCIYQSYPTI HPTPFTLLRP NQEHYKSLLH MSSSFSNLVV STLQQNPAAH  360
AIASLTATCW PYVNPETSVD SPVCDKEGSG TKQMNPTPSI EAIAAATVAA ATAWWAAHGL  420
LPLCAPFHSA FPSAGVSAPV VQSSDTCQNV ESRDKVESSQ QIVALQNQQL DAEQSEALTA  480
QHSGSKLPTH SSSDSEGSGG ANANATVKPA HDEKTPAEVE FHDSNKGKRG KQVDRSSCGS  540
NTPSGSDQEI DATENNDKEE KEEEKDLEMN RPAVESSNRR SRSISNTSES WKEVSDEVKR  600
GRLAFQALFT RDVLPQSFSP PYDVEIENKA SENVEKDSHV VDKDSGASVL DLNGKTCGSS  660
SHQSTERDTS AIGINNGEGE LLTIGLGNGT PKGCRTGFKP YKRCSVEAKE KRMTTSSNHC  720
EEGGQKRLRL EQKATN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819250.0LN681925.1 Cucumis melo genomic scaffold, anchoredscaffold00052.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459826.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_008459825.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_008459824.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_008459823.10.0PREDICTED: protein LHY-like isoform X1
RefseqXP_008459822.10.0PREDICTED: protein LHY-like isoform X1
TrEMBLA0A0A0K9R40.0A0A0A0K9R4_CUCSA; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-103MYB_related family protein