PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021978P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 305aa    MW: 33816.9 Da    PI: 6.841
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021978P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-1884136456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  MELO3C021978P1  84 KKRLNLEQVKALEKSFEVGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 136
                     4568889*********************************************9 PP

2HD-ZIP_I/II127.65.4e-4182172191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dye+Lk++++alk++n+ L++++++L++el
  MELO3C021978P1  82 EKKKRLNLEQVKALEKSFEVGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYEVLKKQFEALKADNDVLQAQNTKLHAEL 172
                     69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-1963139IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1981140IPR009057Homeodomain-like
SMARTSM003892.1E-1781142IPR001356Homeobox domain
PROSITE profilePS5007116.53682138IPR001356Homeobox domain
CDDcd000861.75E-1783139No hitNo description
PfamPF000462.4E-1584136IPR001356Homeobox domain
PRINTSPR000311.1E-5109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5118134IPR000047Helix-turn-helix motif
PfamPF021832.7E-14138178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MASPHHHSHS FMFQSRPAPD HHEYVPSASF NTIPSCPPHL YFHDGVVPVM MKRSMSFSGV  60
ENGCEDVNGD EGLSDDGLAL GEKKKRLNLE QVKALEKSFE VGNKLEPERK MQLAKALGLQ  120
PRQIAIWFQN RRARWKTKQL ERDYEVLKKQ FEALKADNDV LQAQNTKLHA ELLALKTKDS  180
GETVGGGGAT MNLKKENERC WSSDNSCDIN LDISNTQTPI GGGGGRACSQ PGMIKDLFPS  240
AAFRSAAITQ LLQHGSSRST VDQHPQVIQE ESFSQMFNGI EEQQQTAAAA GFWPWSSDQN  300
SHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818890.0LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459304.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20-like
SwissprotQ004665e-79HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A1S3C9V40.0A0A1S3C9V4_CUCME; homeobox-leucine zipper protein ATHB-20-like
STRINGXP_008459304.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-81homeobox 3