PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021789P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 171aa    MW: 18491 Da    PI: 8.2284
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021789P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.12e-45151141100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++Cv+apyfpa+qp+kfanvhk+FGasnv k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i++lq+q++ l+++la
  MELO3C021789P1  15 PCAACKLLRRRCGEECVFAPYFPADQPHKFANVHKVFGASNVNKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCVGAISSLQHQIDALQTQLA 109
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  MELO3C021789P1 110 LAQAE 114
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.45514115IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-4515112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MKTENGRKQG GGAAPCAACK LLRRRCGEEC VFAPYFPADQ PHKFANVHKV FGASNVNKML  60
QELPIHQRGD AVSSLVYEAN ARVRDPVYGC VGAISSLQHQ IDALQTQLAL AQAEVVHLRV  120
RQTASFSNYG LSPTSPSNSG SPSSRLVGSH SRAMFEMDMV VDQAIEDSMW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
GenBankLN6819310.0LN681931.1 Cucumis melo genomic scaffold, anchoredscaffold00049.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459081.11e-126PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE96e-72LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0A0LYG01e-111A0A0A0LYG0_CUCSA; Uncharacterized protein
STRINGGLYMA09G02510.12e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-68LOB domain-containing protein 4