PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021578P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 166aa    MW: 18202.3 Da    PI: 7.8519
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021578P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.36.3e-4410108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC +dC++apyfp e+p kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  MELO3C021578P1  10 PCAACKFLRRKCLADCIFAPYFPPEEPTKFANVHKIFGASNVSKLLNEVQPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELD 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  MELO3C021578P1 105 ATNA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.5419110IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MASSSYTNSP CAACKFLRRK CLADCIFAPY FPPEEPTKFA NVHKIFGASN VSKLLNEVQP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL VRYASGSARP  120
PSQYGRRATT ASVSSTRHHS GLSFLSPLSS NHHDDPYCHE NEEGN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
GenBankLN6818900.0LN681890.1 Cucumis melo genomic scaffold, anchoredscaffold00048.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458801.11e-121PREDICTED: LOB domain-containing protein 25
RefseqXP_008458802.11e-121PREDICTED: LOB domain-containing protein 25
RefseqXP_008458803.11e-121PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q35e-72LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A0A0KSE81e-105A0A0A0KSE8_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s35280.12e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-73LOB domain-containing protein 25