PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021534P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 247aa    MW: 28522.3 Da    PI: 4.3079
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021534P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.3e-203386356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    k++++t+eq++ Le  Fe+++++  e+++eLAkklgL+ rqV vWFqNrRa++k
  MELO3C021534P1 33 KKRRLTQEQVHLLEISFESENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWK 86
                    5679*************************************************9 PP

2HD-ZIP_I/II129.51.4e-4132124193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl++eqv+lLE sFe+e+kLeperK+ela++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+ +++ + + ke+e+L++e+++
  MELO3C021534P1  32 EKKRRLTQEQVHLLEISFESENKLEPERKTELAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSSYDSFRSSYDFIAKENERLKAEVAS 124
                     69***********************************************************************************99999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-201790IPR009057Homeodomain-like
PROSITE profilePS5007117.7992888IPR001356Homeobox domain
SMARTSM003892.5E-193192IPR001356Homeobox domain
CDDcd000861.37E-173389No hitNo description
PfamPF000463.4E-173386IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-213495IPR009057Homeodomain-like
PRINTSPR000311.2E-65968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000311.2E-66884IPR000047Helix-turn-helix motif
PfamPF021838.5E-1788130IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MMGMEETSKR RSFFSSPDDL FDDDYYDDQP PEKKRRLTQE QVHLLEISFE SENKLEPERK  60
TELAKKLGLQ PRQVAVWFQN RRARWKTKQL ERDYDLLKSS YDSFRSSYDF IAKENERLKA  120
EVASLTEKLQ AKEVVESSFH AKNPDPFLED QLLVPVVQQN IKIEDHHSCR SNGSAVLDED  180
GPQLLDSGDS YILSNDYDGC VLPAFGVNSE EEDGSDDGQG YFSDVYTTVD QQTHEGEPLT  240
WWDWTS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18088RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818900.0LN681890.1 Cucumis melo genomic scaffold, anchoredscaffold00048.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458752.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022833e-81HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A1S3C9T90.0A0A1S3C9T9_CUCME; homeobox-leucine zipper protein HAT5-like
STRINGXP_008458752.10.0(Cucumis melo)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-71homeobox 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Arce AL,Chan RL
    A uORF Represses the Transcription Factor AtHB1 in Aerial Tissues to Avoid a Deleterious Phenotype.
    Plant Physiol., 2017. 175(3): p. 1238-1253
    [PMID:28956754]