PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020944P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 311aa    MW: 34948.9 Da    PI: 7.5958
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020944P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.6e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++++l 
  MELO3C020944P1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEFRLRDPVYGCVGLISVLQHKLKQMQTDLY 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  MELO3C020944P1 102 NAKKE 106
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7296107IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEFRLRDPVY GCVGLISVLQ HKLKQMQTDL YNAKKELASY IGPQAMLPIL  120
QPQTTPSPYN HHLSPMMGIV GPSPSPSPSV PGSSQQMIIR DSAVTTPAHH HHHHHHLQQQ  180
QQLFEAQQLA AAVAAREEMF KAYEHKQSQQ QQRQQELLSF NNNNNNQMGA SNLTLGTFVD  240
NSYQQIQQHD HQNSSSHPLQ VQLFLQPQQT QQLEQQHHHH HHQSHKPEST THADDGRINN  300
NNNINIGPSC *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819130.0LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457883.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_008457884.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ35e-77LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0A0LM251e-145A0A0A0LM25_CUCSA; Uncharacterized protein
STRINGPOPTR_0007s11460.11e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-74ASYMMETRIC LEAVES 2-like 1