PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020121P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 245aa    MW: 26813.1 Da    PI: 8.496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020121P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.81.4e-41491481100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA++r+rdPvyG++g i++lq+q+++l+ael+
  MELO3C020121P1  49 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVSENQRADAANSLVYEANVRLRDPVYGCMGAISALQHQIQSLQAELN 143
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MELO3C020121P1 144 AVRAE 148
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.77548149IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-4249146IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSKERERFDE IAKKIKRETD VSSNIPPQQI MGRRHSLQGS PGALNTITPC AACKLLRRRC  60
AQECPFSPYF SPHEPHKFAS VHKVFGASNV SKMLMEVSEN QRADAANSLV YEANVRLRDP  120
VYGCMGAISA LQHQIQSLQA ELNAVRAEIL RHKFREANNM IHSSPQQQHV PFLSSSSSTE  180
VVSVALPPPP PPLPPPHHHD ASSSSSSLYN RPTVAAAADY STISSDENVT YFVSTSSSGH  240
QLNS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
GenBankLN6819000.0LN681900.1 Cucumis melo genomic scaffold, anchoredscaffold00041.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456927.10.0PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T54e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0A0KM941e-150A0A0A0KM94_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s08040.11e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-83LOB domain-containing protein 15