PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019995P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 223aa    MW: 23851.1 Da    PI: 9.0138
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019995P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.71.3e-40321311100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv k+l ++pe++r da++slvyeA+ r+rdPvyG++g i++lq+ql++l+++l+
  MELO3C019995P1  32 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVAKMLMEVPENQRADAANSLVYEANLRLRDPVYGCMGAISALQHQLHTLQSDLN 126
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  MELO3C019995P1 127 AITTQ 131
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.33131132IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4132128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGRRNNNSNN LILSSSSSSQ SSGISNLNTI TPCAACKLLR RRCAQECPFS PYFSPHEPHK  60
FASVHKVFGA SNVAKMLMEV PENQRADAAN SLVYEANLRL RDPVYGCMGA ISALQHQLHT  120
LQSDLNAITT QIFKYKFTHH PINIPSSPNF ISPSPAATPP AAPPTPPHSQ PPPLSLPPPL  180
PPSSSSSSVF SPPIITTATS TTVVELINPI VSTSTQHISY FG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456762.11e-159PREDICTED: LOB domain-containing protein 15-like
SwissprotQ9AT612e-66LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0A0K8P61e-103A0A0A0K8P6_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g07790.t015e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.16e-64LOB domain-containing protein 13