PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019573P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 275aa    MW: 29809.2 Da    PI: 8.7106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019573P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.5e-33148201255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave+LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MELO3C019573P1 148 PRMRWTTSLHARFVHAVEHLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 201
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.02E-15145201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-29146201IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-24148201IPR006447Myb domain, plants
PfamPF002491.4E-7149200IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MFDVSSDGLR PIKGIPVYHN RPFPFLGVDQ KDHHYFHQFP SACFFPNYSN TNGNSGGGGV  60
AQMGYYHRGG GGVGGNNNNC SARFNNGVVC AEAINKCLNN NSNSNSNNNN AASCCCSSSS  120
DVCSSHGMMM MRSRFLQKLP PKRSMRAPRM RWTTSLHARF VHAVEHLGGH ERATPKSVLE  180
LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA SSGQSDGSGE DDVSPTIMGT TRGDHGGSKQ  240
FCDQRAPPDR SAQPPSDMEF GCSTLWSNSS RLVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-18149203357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-18149203357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-18149203357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-18149203357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-18149203458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818510.0LN681851.1 Cucumis melo genomic scaffold, anchoredscaffold00038.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456200.10.0PREDICTED: transcription repressor KAN1-like isoform X2
TrEMBLA0A1S3C2P00.0A0A1S3C2P0_CUCME; transcription repressor KAN1-like isoform X2
STRINGXP_008456199.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-46G2-like family protein