PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019314P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 239aa    MW: 26823.1 Da    PI: 8.7294
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019314P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.72.2e-3414102189
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                     aCaaCk++r+kC + C+lapyfpa+++++f++vhk+FG+snv+k++k+++ee++++a++sl++eA +r++dPv G +g ++++ ++++ 
  MELO3C019314P1  14 ACAACKHQRKKCHETCPLAPYFPADRNREFQAVHKVFGVSNVTKMVKNVREEDKRKAVDSLIWEAVCRQNDPVLGPYGEYKRVLEEVKV 102
                     7*****************************************************************************99998887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.76313113IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3314102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MQRHNNGLLQ ATPACAACKH QRKKCHETCP LAPYFPADRN REFQAVHKVF GVSNVTKMVK  60
NVREEDKRKA VDSLIWEAVC RQNDPVLGPY GEYKRVLEEV KVCKLLTQNQ SIMNGGQVGL  120
GYKPIMPCLG PWNNNNNNNS NNNTNNNNNN NGNLINNGNG IMGIINGGVN SNHLFNYLHD  180
NYVSAIIDSS PYSNSSTYNL QSPEKLMRLQ QDKEITSSMV GPLQQQQQQQ HPTFHHCF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819160.0LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LNB98e-45LBD2_ARATH; LOB domain-containing protein 2
STRINGSolyc12g010810.1.12e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-44LOB domain-containing protein 2