PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019250P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 724aa    MW: 79508 Da    PI: 5.7347
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019250P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.5e-2059115157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  MELO3C019250P1  59 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 115
                     688999************************************************995 PP

2START2275.7e-712504701206
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el ++a+ +ep+W++       ++n+de+l++f+++ +     ++ ea+r+s+vv+m++ +lve+l+d++ qW++ +     +a+tl
  MELO3C019250P1 250 ELAVAAMEELTRMAQMGEPLWMTTLdgstHMLNEDEYLRTFPRGIGpkpsgFKCEASRESAVVIMNHINLVEILMDVN-QWSTLFSgivsRAMTL 343
                     57899***********************9**************999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ev+s+g      galq+m++e+q++splvp R+++fvRy++q+g+g+w++vdvS+d  ++ p    +vR++++pSg+li++++ng+skvtwvehv
  MELO3C019250P1 344 EVLSTGvagnynGALQVMTSEFQVPSPLVPtRESYFVRYCKQHGDGTWAVVDVSLDDLRPTP----GVRCRRRPSGCLIQEMPNGYSKVTWVEHV 434
                     ************************************************************99....6**************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r +h+l+++lv+sg+a+gak+wv tl+rqce+
  MELO3C019250P1 435 EVDDRGVHNLYKQLVSSGQAFGAKRWVTTLDRQCER 470
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2239114IPR009057Homeodomain-like
SuperFamilySSF466897.1E-2046116IPR009057Homeodomain-like
PROSITE profilePS5007117.05456116IPR001356Homeobox domain
SMARTSM003892.4E-2057120IPR001356Homeobox domain
PfamPF000463.8E-1859114IPR001356Homeobox domain
CDDcd000861.26E-1959117No hitNo description
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
SuperFamilySSF559615.98E-38241472No hitNo description
PROSITE profilePS5084845.431241473IPR002913START domain
CDDcd088753.76E-131245469No hitNo description
SMARTSM002341.3E-67250470IPR002913START domain
PfamPF018522.8E-60251470IPR002913START domain
Gene3DG3DSA:3.30.530.207.8E-7346439IPR023393START-like domain
SuperFamilySSF559618.24E-26489715No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 724 aa     Download sequence    Send to blast
MFQPSIMDAH LLPLDIPQNT SESDLARIRD DDFDSATKSG SDNNHELVSG DDQDPRPKKK  60
RYHRHTQHQI QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKNQHERH  120
ENTQLRTENE KLRADNMRYR EALSNASCPN CGGPTAIGEM SFDEHHLRLE NARLREEIDR  180
ISAIAAKYVG KPVVNYPLLS PPVPSRPLEL GMANFGPQPG LGGGDIYGSA SDLIRSISAP  240
TEADKPMIIE LAVAAMEELT RMAQMGEPLW MTTLDGSTHM LNEDEYLRTF PRGIGPKPSG  300
FKCEASRESA VVIMNHINLV EILMDVNQWS TLFSGIVSRA MTLEVLSTGV AGNYNGALQV  360
MTSEFQVPSP LVPTRESYFV RYCKQHGDGT WAVVDVSLDD LRPTPGVRCR RRPSGCLIQE  420
MPNGYSKVTW VEHVEVDDRG VHNLYKQLVS SGQAFGAKRW VTTLDRQCER LASAMATNIP  480
TGDVGVITNQ EGRKSMLKLA ERMVISFCAG VSASTTHTWT TLSGTGADDV RVMTRKSIDD  540
PGRPHGIVLS AATSFWLPVP PKRIFDFLRD ENSRSEWDIL SNGGVVQEMA HIANGRDTGN  600
CVSLLRVNSA NSSQSNMLIL QESCTDPTAS FVIYAPVDVV AMNLVLNGGD PDYVALLPSG  660
FAILPDGGGG EGVSGGSLLT VAFQILVDSV PTAKLSLGSV ATVNNLIACT VERIKASLSC  720
ENA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819160.0LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455853.10.0PREDICTED: homeobox-leucine zipper protein HDG2-like isoform X2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A1S3C3530.0A0A1S3C353_CUCME; homeobox-leucine zipper protein HDG2-like isoform X2
STRINGXP_008455850.10.0(Cucumis melo)
STRINGXP_004151882.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2